TrkB (NTRK2) (NM_001007097) Human Mass Spec Standard

SKU
PH305129
NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_001007098)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC205129]
Predicted MW 53.1 kDa
Protein Sequence
Protein Sequence
>RC205129 protein sequence
Red=Cloning site Green=Tags(s)

MSSWIRWHGPAMARLWGFCWLVVGFWRAAFACPTSCKCSASRIWCSDPSPGIVAFPRLEPNSVDPENITE
IFIANQKRLEIINEDDVEAYVGLRNLTIVDSGLKFVAHKAFLKNSNLQHINFTRNKLTSLSRKHFRHLDL
SELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPSANLAAPNLTVEE
GKSITLSCSVAGDPVPNMYWDVGNLVSKHMNETSHTQGSLRITNISSDDSGKQISCVAENLVGEDQDSVN
LTVHFAPTITFLESPTSDHHWCIPFTVKGNPKPALQWFYNGAILNESKYICTKIHVTNHTEYHGCLQLDN
PTHMNNGDYTLIAKNEYGKDEKQISAHFMGWPGIDDGANPNYPDVIYEDYGTAANDIGDTTNRSNEIPST
DVTDKTGREHLSVYAVVVIASVVGFCLLVMLFLLKLARHSKFGMKGFVLFHKIPLDG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001007098
RefSeq Size 7157
RefSeq ORF 1431
Synonyms DEE58; EIEE58; GP145-TrkB; OBHD; trk-B; TRKB
Locus ID 4915
UniProt ID Q16620
Cytogenetics 9q21.33
Summary This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation. Mutations in this gene have been associated with obesity and mood disorders. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways MAPK signaling pathway, Neurotrophin signaling pathway
Write Your Own Review
You're reviewing:TrkB (NTRK2) (NM_001007097) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321794 NTRK2 MS Standard C13 and N15-labeled recombinant protein (NP_006171) 10 ug
$3,255.00
LC400391 NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416818 NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422715 NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422716 NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422717 NTRK2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400391 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b 100 ug
$436.00
LY416818 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a 100 ug
$665.00
LY422715 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant c 100 ug
$665.00
LY422716 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant d 100 ug
$665.00
LY422717 Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant e 100 ug
$665.00
TP305129 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b, 20 µg 20 ug
$737.00
TP321794 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, 20 µg 20 ug
$737.00
TP700135 Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2(NTRK2), transcript variant c, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP710139 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant a, residues 32-430aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP720421 Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 2 (NTRK2), transcript variant b 10 ug
$170.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.