RAB23 (NM_183227) Human Recombinant Protein

SKU
TP321508
Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221508 protein sequence
Red=Cloning site Green=Tags(s)

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE
FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA
KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN
GGDVINLRPNKQRTKKNRNPFSSCSIP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_899050
Locus ID 51715
UniProt ID Q9ULC3
Cytogenetics 6p12.1-p11.2
RefSeq Size 4391
RefSeq ORF 711
Synonyms HSPC137
Summary This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Protein Families Druggable Genome
Protein Pathways Hedgehog signaling pathway
Write Your Own Review
You're reviewing:RAB23 (NM_183227) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301922 RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) 10 ug
$3,255.00
PH321508 RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_899050) 10 ug
$3,255.00
LC402532 RAB23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405187 RAB23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402532 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 100 ug
$436.00
LY405187 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 2 100 ug
$436.00
TP301922 Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.