RAB23 (NM_016277) Human Mass Spec Standard

SKU
PH301922
RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201922]
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC201922 protein sequence
Red=Cloning site Green=Tags(s)

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE
FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA
KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN
GGDVINLRPNKQRTKKNRNPFSSCSIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057361
RefSeq Size 4837
RefSeq ORF 711
Synonyms HSPC137
Locus ID 51715
UniProt ID Q9ULC3
Cytogenetics 6p12.1-p11.2
Summary This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Protein Families Druggable Genome
Protein Pathways Hedgehog signaling pathway
Write Your Own Review
You're reviewing:RAB23 (NM_016277) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH321508 RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_899050) 10 ug
$3,255.00
LC402532 RAB23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405187 RAB23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402532 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 100 ug
$436.00
LY405187 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 2 100 ug
$436.00
TP301922 Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321508 Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.