OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB23 (NM_183227) Human Mass Spec Standard

Be the first to review this product
SKU
PH321508
RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_899050)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA809380 RAB23 mouse monoclonal antibody,clone OTI2A8 100 ul
$447.00
LY402532 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "RAB23 or NM_183227"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221508
Predicted MW 26.7 kDa
Protein Sequence
Protein Sequence
>RC221508 protein sequence
Red=Cloning site Green=Tags(s)

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEE
FDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALA
KRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLN
GGDVINLRPNKQRTKKNRNPFSSCSIP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_899050
RefSeq Size 4391
RefSeq ORF 711
Synonyms HSPC137
Locus ID 51715
UniProt ID Q9ULC3
Cytogenetics 6p12.1-p11.2
Summary This gene encodes a small GTPase of the Ras superfamily. Rab proteins are involved in the regulation of diverse cellular functions associated with intracellular membrane trafficking, including autophagy and immune response to bacterial infection. The encoded protein may play a role in central nervous system development by antagonizing sonic hedgehog signaling. Disruption of this gene has been implicated in Carpenter syndrome as well as cancer. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Protein Families Druggable Genome
Protein Pathways Hedgehog signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB23" proteins (7)
SKU Description Size Price
PH301922 RAB23 MS Standard C13 and N15-labeled recombinant protein (NP_057361) 10 ug
$3,360.00
LC402532 Lyophilized RAB23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405187 Lyophilized RAB23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402532 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405187 Transient overexpression lysate of RAB23, member RAS oncogene family (RAB23), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301922 Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 1, 20 µg 20 ug
$867.00
TP321508 Recombinant protein of human RAB23, member RAS oncogene family (RAB23), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products