Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein

SKU
TP321235
Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221235 protein sequence
Red=Cloning site Green=Tags(s)

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN
CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR
QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002565
Locus ID 5052
UniProt ID Q06830
Cytogenetics 1p34.1
RefSeq Size 1263
RefSeq ORF 597
Synonyms MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2
Summary This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jan 2011]
Write Your Own Review
You're reviewing:Peroxiredoxin 1 (PRDX1) (NM_002574) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305072 PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) 10 ug
$3,255.00
PH321235 PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_002565) 10 ug
$3,255.00
PH322186 PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859047) 10 ug
$3,255.00
LC403646 PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405338 PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419239 PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403646 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 100 ug
$436.00
LY405338 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 100 ug
$436.00
LY419239 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 1 100 ug
$436.00
TP305072 Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 3, 20 µg 20 ug
$737.00
TP322186 Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 2, 20 µg 20 ug
$737.00
TP721190 Purified recombinant protein of Human peroxiredoxin 1 (PRDX1), transcript variant 3 10 ug
$185.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.