Peroxiredoxin 1 (PRDX1) (NM_002574) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC221235] |
Predicted MW | 22.1 kDa |
Protein Sequence |
Protein Sequence
>RC221235 protein sequence
Red=Cloning site Green=Tags(s) MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002565 |
RefSeq Size | 1263 |
RefSeq ORF | 597 |
Synonyms | MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2 |
Locus ID | 5052 |
UniProt ID | Q06830 |
Cytogenetics | 1p34.1 |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jan 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305072 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) | 10 ug |
$3,255.00
|
|
PH322186 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859047) | 10 ug |
$3,255.00
|
|
LC403646 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405338 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419239 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403646 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 | 100 ug |
$436.00
|
|
LY405338 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 | 100 ug |
$436.00
|
|
LY419239 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 1 | 100 ug |
$436.00
|
|
TP305072 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP321235 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP322186 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP721190 | Purified recombinant protein of Human peroxiredoxin 1 (PRDX1), transcript variant 3 | 10 ug |
$185.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.