OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Peroxiredoxin 1 (PRDX1) (NM_181697) Human Mass Spec Standard

Be the first to review this product
SKU
PH305072
PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA346666 Rabbit Polyclonal Anti-PRDX1 Antibody
100 ul
$585.00
LY403646 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "Peroxiredoxin 1 or NM_181697"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC205072
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC205072 protein sequence
Red=Cloning site Green=Tags(s)

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN
CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR
QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_859048
RefSeq Size 1043
RefSeq ORF 597
Synonyms MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2
Locus ID 5052
UniProt ID Q06830
Cytogenetics 1p34.1
Summary This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. provided by RefSeq, Jan 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Peroxiredoxin 1" proteins (12)
SKU Description Size Price
PH321235 PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_002565) 10 ug
$3,360.00
PH322186 PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859047) 10 ug
$3,360.00
LC403646 Lyophilized PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405338 Lyophilized PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC419239 Lyophilized PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403646 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405338 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY419239 Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP305072 Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 3, 20 µg 20 ug
$737.00
TP321235 Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1, 20 µg 20 ug
$737.00
TP322186 Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 2, 20 µg 20 ug
$737.00
TP721190 Purified recombinant protein of Human peroxiredoxin 1 (PRDX1), transcript variant 3 10 ug
$190.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products