Peroxiredoxin 1 (PRDX1) (NM_181697) Human Recombinant Protein
SKU
TP305072
Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 3, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC205072 protein sequence
Red=Cloning site Green=Tags(s) MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_859048 |
Locus ID | 5052 |
UniProt ID | Q06830 |
Cytogenetics | 1p34.1 |
RefSeq Size | 1043 |
RefSeq ORF | 597 |
Synonyms | MSP23; NKEF-A; NKEFA; PAG; PAGA; PAGB; PRX1; PRXI; TDPX2 |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. Four transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jan 2011] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH305072 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859048) | 10 ug |
$3,255.00
|
|
PH321235 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_002565) | 10 ug |
$3,255.00
|
|
PH322186 | PRDX1 MS Standard C13 and N15-labeled recombinant protein (NP_859047) | 10 ug |
$3,255.00
|
|
LC403646 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405338 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC419239 | PRDX1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403646 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 2 | 100 ug |
$436.00
|
|
LY405338 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 3 | 100 ug |
$436.00
|
|
LY419239 | Transient overexpression lysate of peroxiredoxin 1 (PRDX1), transcript variant 1 | 100 ug |
$436.00
|
|
TP321235 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP322186 | Recombinant protein of human peroxiredoxin 1 (PRDX1), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP721190 | Purified recombinant protein of Human peroxiredoxin 1 (PRDX1), transcript variant 3 | 10 ug |
$185.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.