VCX3A (NM_016379) Human Recombinant Protein

SKU
TP321002
Recombinant protein of human variable charge, X-linked 3A (VCX3A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221002 protein sequence
Red=Cloning site Green=Tags(s)

MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV
EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 19.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057463
Locus ID 51481
UniProt ID Q9NNX9
Cytogenetics Xp22.31
RefSeq Size 1004
RefSeq ORF 558
Synonyms VCX-8r; VCX-A; VCX3; VCX8R; VCXA
Summary This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:VCX3A (NM_016379) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321002 VCX3A MS Standard C13 and N15-labeled recombinant protein (NP_057463) 10 ug
$3,255.00
LC413983 VCX3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413983 Transient overexpression lysate of variable charge, X-linked 3A (VCX3A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.