VCX3A (NM_016379) Human Recombinant Protein

SKU TP321002L

Recombinant protein of human variable charge, X-linked 3A (VCX3A), 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC221002 protein sequence; Red=Cloning site Green=Tags(s); ; MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG; PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV; EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057463
• Locus ID: 51481
• UniProt ID: Q9NNX9
• Cytogenetics: Xp22.31
• RefSeq Size: 1004
• RefSeq ORF: 558
• Synonyms: VCX-8r; VCX-A; VCX3; VCX8R; VCXA
• Summary: This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008]