VCX3A (NM_016379) Human Tagged ORF Clone
SKU
RC221002
VCX3A (Myc-DDK-tagged)-Human variable charge, X-linked 3A (VCX3A)
-
TrueORF Gold
Protein expression verified by Western blot, fully sequenced and in stock
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | VCX3A |
Synonyms | VCX-8r; VCX-A; VCX3; VCX8R; VCXA |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC221002 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAGTCCAAAGCCGAGAGCCTCGGGACCTCCGGCCAAGGCCAGGGAGGCAGGAAAGAGGAAGTCCTCCT CTCAGCCGAGCCCCAGTGACCCGAAGAAGAAGACTACCAAGGTGGCCAAGAAGGGAAAAGCAGTTCGTAG AGGGAGACGCGGGAAGAAAGGGGCTGCGACAAAGATGGCGGCCGTGACGGCACCTGAGGCGGAGAGCGGG CCAGCGGCACCCGGCCCCAGCGACCAGCCCAGCCAGGAGCTCCCTCAGCACGAGCTGCCGCCGGAGGAGC CAGTGAGCGAGGGGACCCAGCACGACCCCCCGAGTCAGGAGAGCCAGCTGGAGGAACCACTGAGTCAGGA GAGCGAGGTGGAAGAACCACTGAGTCAGGAGAGCCAGGTGGAGGAACCACTGAGTCAGGAGAGCGAGGTG GAGGAACCACTGAGTCAGGAGAGCCAGGTGGAGGAACCACTGAGTCAGGAGAGCGAGATGGAAGAACCAC TGAGTCAGGAGAGCCAGGTGGAGGAACCACCGAGTCAGGAGAGCGAGATGGAAGAACTACCGAGTGTG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221002 protein sequence
Red=Cloning site Green=Tags(s) MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_016379 |
ORF Size | 558 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_016379.4 |
RefSeq Size | 1004 bp |
RefSeq ORF | 561 bp |
Locus ID | 51481 |
UniProt ID | Q9NNX9 |
Cytogenetics | Xp22.31 |
MW | 20.1 kDa |
Summary | This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC221002L1 | Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC221002L2 | Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), mGFP tagged | 10 ug |
$600.00
|
|
RC221002L3 | Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), Myc-DDK-tagged | 10 ug |
$600.00
|
|
RC221002L4 | Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), mGFP tagged | 10 ug |
$600.00
|
|
RG221002 | VCX3A (tGFP-tagged) - Human variable charge, X-linked 3A (VCX3A) | 10 ug |
$489.00
MSRP
$500.00
MSRP
$500.00
|
|
SC304413 | VCX3A (untagged)-Human variable charge, X-linked 3A (VCX3A) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.