VCX3A (NM_016379) Human Tagged ORF Clone

SKU
RG221002
VCX3A (tGFP-tagged) - Human variable charge, X-linked 3A (VCX3A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VCX3A
Synonyms VCX-8r; VCX-A; VCX3; VCX8R; VCXA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG221002 representing NM_016379
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTCCAAAGCCGAGAGCCTCGGGACCTCCGGCCAAGGCCAGGGAGGCAGGAAAGAGGAAGTCCTCCT
CTCAGCCGAGCCCCAGTGACCCGAAGAAGAAGACTACCAAGGTGGCCAAGAAGGGAAAAGCAGTTCGTAG
AGGGAGACGCGGGAAGAAAGGGGCTGCGACAAAGATGGCGGCCGTGACGGCACCTGAGGCGGAGAGCGGG
CCAGCGGCACCCGGCCCCAGCGACCAGCCCAGCCAGGAGCTCCCTCAGCACGAGCTGCCGCCGGAGGAGC
CAGTGAGCGAGGGGACCCAGCACGACCCCCCGAGTCAGGAGAGCCAGCTGGAGGAACCACTGAGTCAGGA
GAGCGAGGTGGAAGAACCACTGAGTCAGGAGAGCCAGGTGGAGGAACCACTGAGTCAGGAGAGCGAGGTG
GAGGAACCACTGAGTCAGGAGAGCCAGGTGGAGGAACCACTGAGTCAGGAGAGCGAGATGGAAGAACCAC
TGAGTCAGGAGAGCCAGGTGGAGGAACCACCGAGTCAGGAGAGCGAGATGGAAGAACTACCGAGTGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221002 representing NM_016379
Red=Cloning site Green=Tags(s)

MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV
EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016379
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016379.2, NP_057463.2
RefSeq Size 1004 bp
RefSeq ORF 561 bp
Locus ID 51481
UniProt ID Q9NNX9
Cytogenetics Xp22.31
Summary This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:VCX3A (NM_016379) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221002 VCX3A (Myc-DDK-tagged)-Human variable charge, X-linked 3A (VCX3A) 10 ug
$300.00
RC221002L1 Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), Myc-DDK-tagged 10 ug
$600.00
RC221002L2 Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), mGFP tagged 10 ug
$600.00
RC221002L3 Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), Myc-DDK-tagged 10 ug
$600.00
RC221002L4 Lenti ORF clone of Human variable charge, X-linked 3A (VCX3A), mGFP tagged 10 ug
$600.00
SC304413 VCX3A (untagged)-Human variable charge, X-linked 3A (VCX3A) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.