OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VCX3A (NM_016379) Human Mass Spec Standard

Be the first to review this product
SKU
PH321002
VCX3A MS Standard C13 and N15-labeled recombinant protein (NP_057463)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331913 Rabbit Polyclonal Anti-VCX3A Antibody
100 ul
$585.00
LY413983 Transient overexpression lysate of variable charge, X-linked 3A (VCX3A) (as WB positive control) 100 ug
$436.00

Other products for "VCX3A or NM_016379"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC221002
Predicted MW 20.1 kDa
Protein Sequence
Protein Sequence
>RC221002 protein sequence
Red=Cloning site Green=Tags(s)

MSPKPRASGPPAKAREAGKRKSSSQPSPSDPKKKTTKVAKKGKAVRRGRRGKKGAATKMAAVTAPEAESG
PAAPGPSDQPSQELPQHELPPEEPVSEGTQHDPPSQESQLEEPLSQESEVEEPLSQESQVEEPLSQESEV
EEPLSQESQVEEPLSQESEMEEPLSQESQVEEPPSQESEMEELPSV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057463
RefSeq Size 1004
RefSeq ORF 558
Synonyms VCX-8r; VCX-A; VCX3; VCX8R; VCXA
Locus ID 51481
UniProt ID Q9NNX9
Cytogenetics Xp22.31
Summary This gene belongs to the VCX/Y gene family, which has multiple members on both X and Y chromosomes, and all are expressed exclusively in male germ cells. The X-linked members are clustered on chromosome Xp22 and Y-linked members are two identical copies of the gene within a palindromic region on Yq11. The family members share a high degree of sequence identity, with the exception that a 30-bp unit is tandemly repeated in X-linked members but occurs only once in Y-linked members. The VCX gene cluster is polymorphic in terms of copy number; different individuals may have a different number of VCX genes. VCX/Y genes encode small and highly charged proteins of unknown function. The presence of a putative bipartite nuclear localization signal suggests that VCX/Y members are nuclear proteins. This gene contains 8 repeats of the 30-bp unit. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VCX3A" proteins (3)
SKU Description Size Price
LC413983 Lyophilized VCX3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413983 Transient overexpression lysate of variable charge, X-linked 3A (VCX3A) (as WB positive control) 100 ug
$436.00
TP321002 Recombinant protein of human variable charge, X-linked 3A (VCX3A), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products