MAGP1 (MFAP2) (NM_002403) Human Recombinant Protein

SKU TP320225

Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC220225 representing NM_002403; Red=Cloning site Green=Tags(s); ; MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV; QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT; VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_002394
• Locus ID: 4237
• UniProt ID: P55001
• Cytogenetics: 1p36.13
• RefSeq Size: 1066
• RefSeq ORF: 549
• Synonyms: MAGP; MAGP-1; MAGP1
• Summary: Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
• Protein Families: Secreted Protein