MAGP1 (MFAP2) (NM_017459) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202188] |
Predicted MW | 20.8 kDa |
Protein Sequence |
Protein Sequence
>RC202188 protein sequence
Red=Cloning site Green=Tags(s) MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_059453 |
RefSeq Size | 1105 |
RefSeq ORF | 549 |
Synonyms | MAGP; MAGP-1; MAGP1 |
Locus ID | 4237 |
UniProt ID | P55001 |
Cytogenetics | 1p36.13 |
Summary | Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH320225 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002394) | 10 ug |
$3,255.00
|
|
PH325196 | MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719) | 10 ug |
$3,255.00
|
|
LC400857 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413763 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427608 | MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400857 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 2 | 100 ug |
$436.00
|
|
LY413763 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 1 | 100 ug |
$436.00
|
|
LY427608 | Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 3 | 100 ug |
$436.00
|
|
TP302188 | Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP320225 | Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP325196 | Purified recombinant protein of Homo sapiens microfibrillar-associated protein 2 (MFAP2), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.