MAGP1 (MFAP2) (NM_017459) Human Recombinant Protein

SKU
TP302188
Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202188 protein sequence
Red=Cloning site Green=Tags(s)

MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV
QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT
VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_059453
Locus ID 4237
UniProt ID P55001
Cytogenetics 1p36.13
RefSeq Size 1105
RefSeq ORF 549
Synonyms MAGP; MAGP-1; MAGP1
Summary Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:MAGP1 (MFAP2) (NM_017459) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302188 MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059453) 10 ug
$3,255.00
PH320225 MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002394) 10 ug
$3,255.00
PH325196 MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719) 10 ug
$3,255.00
LC400857 MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413763 MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427608 MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400857 Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 2 100 ug
$436.00
LY413763 Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 1 100 ug
$436.00
LY427608 Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 3 100 ug
$436.00
TP320225 Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2, 20 µg 20 ug
$737.00
TP325196 Purified recombinant protein of Homo sapiens microfibrillar-associated protein 2 (MFAP2), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.