MAGP1 (MFAP2) (NM_002403) Human Mass Spec Standard

SKU
PH320225
MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_002394)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC220225]
Predicted MW 20.83 kDa
Protein Sequence
Protein Sequence
>RC220225 representing NM_002403
Red=Cloning site Green=Tags(s)

MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQV
QQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRT
VCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002394
RefSeq Size 1066
RefSeq ORF 549
Synonyms MAGP; MAGP-1; MAGP1
Locus ID 4237
UniProt ID P55001
Cytogenetics 1p36.13
Summary Microfibrillar-associated protein 2 is a major antigen of elastin-associated microfibrils and a candidate for involvement in the etiology of inherited connective tissue diseases. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]
Protein Families Secreted Protein
Write Your Own Review
You're reviewing:MAGP1 (MFAP2) (NM_002403) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH302188 MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059453) 10 ug
$3,255.00
PH325196 MFAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001128719) 10 ug
$3,255.00
LC400857 MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC413763 MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427608 MFAP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400857 Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 2 100 ug
$436.00
LY413763 Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 1 100 ug
$436.00
LY427608 Transient overexpression lysate of microfibrillar-associated protein 2 (MFAP2), transcript variant 3 100 ug
$436.00
TP302188 Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 1, 20 µg 20 ug
$737.00
TP320225 Recombinant protein of human microfibrillar-associated protein 2 (MFAP2), transcript variant 2, 20 µg 20 ug
$737.00
TP325196 Purified recombinant protein of Homo sapiens microfibrillar-associated protein 2 (MFAP2), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.