OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD59 (NM_000611) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318343
Recombinant protein of human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA507349 CD59 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CD59 or NM_000611"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218343 protein sequence
Red=Cloning site Green=Tags(s)

MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000602
Locus ID 966
UniProt ID P13987
Cytogenetics 11p13
RefSeq Size 7635
RefSeq ORF 384
Synonyms 1F5; 16.3A5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20
Summary This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. provided by RefSeq, Jul 2008
Protein Categories CD Markers, Immune system diseases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome
Protein Pathways Complement and coagulation cascades, Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD59" proteins (23)
SKU Description Size Price
PH318343 CD59 MS Standard C13 and N15-labeled recombinant protein (NP_000602) 10 ug
$3,360.00
LC404397 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404398 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404399 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424608 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426723 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426724 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426725 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426726 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430908 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430909 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430910 Lyophilized CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404397 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404398 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404399 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY424608 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426723 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY426724 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY426725 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY426726 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 8 (as WB positive control) 100 ug
$436.00
LY430908 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY430909 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430910 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 4 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products