CD59 (NM_000611) Human Recombinant Protein

SKU
TP318343
Recombinant protein of human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218343 protein sequence
Red=Cloning site Green=Tags(s)

MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC
NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000602
Locus ID 966
UniProt ID P13987
Cytogenetics 11p13
RefSeq Size 7635
RefSeq ORF 384
Synonyms 1F5; 16.3A5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20
Summary This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Complement and coagulation cascades, Hematopoietic cell lineage
Write Your Own Review
You're reviewing:CD59 (NM_000611) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH318343 CD59 MS Standard C13 and N15-labeled recombinant protein (NP_000602) 10 ug
$3,255.00
LC404397 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404398 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404399 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424608 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426723 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426724 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426725 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426726 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430908 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430909 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430910 CD59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404397 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 3 100 ug
$436.00
LY404398 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 1 100 ug
$436.00
LY404399 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 4 100 ug
$436.00
LY424608 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 2 100 ug
$436.00
LY426723 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 5 100 ug
$436.00
LY426724 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 6 100 ug
$436.00
LY426725 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 7 100 ug
$436.00
LY426726 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 8 100 ug
$436.00
LY430908 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 3 100 ug
$436.00
LY430909 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 1 100 ug
$436.00
LY430910 Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.