HOMER2 (NM_199332) Human Recombinant Protein

CAT#: TP318155

Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg

Product Images

Coomassie blue staining of purified HOMER2 protein (Cat# TP318155). The protein was produced from HEK293T cells transfected with HOMER2 cDNA clone (Cat# RC218155) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218155 representing NM_199332
  Red=Cloning site Green=Tags(s)
  
  MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT
  SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ
  ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKET
  ELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDG
  KIDDLHDFRRGLSKLGTDN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_955364
• Locus ID: 9455
• UniProt ID: Q9NSB8
• Cytogenetics: 15q25.2
• Refseq Size: 1840
• Refseq ORF: 897
• Synonyms: ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2
• Summary: This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011]
• Protein Families: Druggable Genome