MET (NM_000245) Human Recombinant Protein

SKU
TP317003
Recombinant protein of human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217003 representing NM_000245
Red=Cloning site Green=Tags(s)

MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYI
YVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGT
CQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP
LHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIR
FCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK
PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEV
IVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQI
CLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAM
NKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK
SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSV
SVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIE
WKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHL
DRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT
VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGE
VSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAK
GMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSF
SELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 153 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000236
Locus ID 4233
UniProt ID P08581
Cytogenetics 7q31.2
RefSeq Size 6641
RefSeq ORF 4170
Synonyms AUTS9; c-Met; DFNB97; HGFR; RCCP2
Summary This gene encodes a member of the receptor tyrosine kinase family of proteins and the product of the proto-oncogene MET. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that are linked via disulfide bonds to form the mature receptor. Further processing of the beta subunit results in the formation of the M10 peptide, which has been shown to reduce lung fibrosis. Binding of its ligand, hepatocyte growth factor, induces dimerization and activation of the receptor, which plays a role in cellular survival, embryogenesis, and cellular migration and invasion. Mutations in this gene are associated with papillary renal cell carcinoma, hepatocellular carcinoma, and various head and neck cancers. Amplification and overexpression of this gene are also associated with multiple human cancers. [provided by RefSeq, May 2016]
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Adherens junction, Axon guidance, Colorectal cancer, Cytokine-cytokine receptor interaction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Focal adhesion, Melanoma, Pathways in cancer, Renal cell carcinoma
Write Your Own Review
You're reviewing:MET (NM_000245) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH317003 MET MS Standard C13 and N15-labeled recombinant protein (NP_000236) 10 ug
$3,255.00
LC400094 MET HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426803 MET HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400094 Transient overexpression lysate of met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2 100 ug
$665.00
LY426803 Transient overexpression lysate of met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 1 100 ug
$665.00
TP700130 Purified recombinant protein of human met proto-oncogene (hepatocyte growth factor receptor)(MET), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$867.00
TP750192 Purified recombinant protein of Human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, Thr678-Ile743, tag free, expressed in E.coli, 50ug 50 ug
$362.00
TP762409 Purified recombinant protein of Human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, Phe146-Thr230-GGGGS-Ile850-Leu920, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762492 Purified recombinant protein of Human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, 1100Asn-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.