MET (NM_000245) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC217003] |
Predicted MW | 155.54 kDa |
Protein Sequence |
Protein Sequence
>RC217003 representing NM_000245
Red=Cloning site Green=Tags(s) MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYI YVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTYYDDQLISCGSVNRGT CQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSALGAKVLSSVKDRFINFFVGNTINSSYFPDHP LHSISVRRLKETKDGFMFLTDQSYIDVLPEFRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIR FCSINSGLHSYMEMPLECILTEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSK PDSAEPMDRSAMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFLLDSHPVSPEV IVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGTWTQQI CLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKKTRVLLGNESCTLTLSESTMNTLKCTVGPAM NKHFNMSIIISNGHGTTQYSTFSYVDPVITSISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLK SVSNSILECYTPAQTISTEFAVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSV SVPRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDLLKLNSELNIE WKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQIKDLGSELVRYDARVHTPHL DRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNT VHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGE VSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAK GMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMRPSF SELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000236 |
RefSeq Size | 6641 |
RefSeq ORF | 4170 |
Synonyms | AUTS9; c-Met; DFNB97; HGFR; RCCP2 |
Locus ID | 4233 |
UniProt ID | P08581 |
Cytogenetics | 7q31.2 |
Summary | This gene encodes a member of the receptor tyrosine kinase family of proteins and the product of the proto-oncogene MET. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that are linked via disulfide bonds to form the mature receptor. Further processing of the beta subunit results in the formation of the M10 peptide, which has been shown to reduce lung fibrosis. Binding of its ligand, hepatocyte growth factor, induces dimerization and activation of the receptor, which plays a role in cellular survival, embryogenesis, and cellular migration and invasion. Mutations in this gene are associated with papillary renal cell carcinoma, hepatocellular carcinoma, and various head and neck cancers. Amplification and overexpression of this gene are also associated with multiple human cancers. [provided by RefSeq, May 2016] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Protein Pathways | Adherens junction, Axon guidance, Colorectal cancer, Cytokine-cytokine receptor interaction, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Focal adhesion, Melanoma, Pathways in cancer, Renal cell carcinoma |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC400094 | MET HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC426803 | MET HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400094 | Transient overexpression lysate of met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2 | 100 ug |
$665.00
|
|
LY426803 | Transient overexpression lysate of met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 1 | 100 ug |
$665.00
|
|
TP317003 | Recombinant protein of human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP700130 | Purified recombinant protein of human met proto-oncogene (hepatocyte growth factor receptor)(MET), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg | 20 ug |
$867.00
|
|
TP750192 | Purified recombinant protein of Human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, Thr678-Ile743, tag free, expressed in E.coli, 50ug | 50 ug |
$362.00
|
|
TP762409 | Purified recombinant protein of Human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, Phe146-Thr230-GGGGS-Ile850-Leu920, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$249.00
|
|
TP762492 | Purified recombinant protein of Human met proto-oncogene (hepatocyte growth factor receptor) (MET), transcript variant 2, 1100Asn-End, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$226.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.