G protein alpha S (GNAS) (NM_001077489) Human Recombinant Protein

SKU
TP316883
Purified recombinant protein of Homo sapiens GNAS complex locus (GNAS), transcript variant 7, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216883 representing NM_001077489
Red=Cloning site Green=Tags(s)

MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNG
DEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWE
DEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVG
GQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQD
LLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCYPHFTC
AVDTENIRRVFNDCRDIIQRMHLRQYELL

TRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 44 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001070957
Locus ID 2778
UniProt ID P63092
Cytogenetics 20q13.32
RefSeq Size 1881
RefSeq ORF 1137
Synonyms AHO; C20orf45; GNAS1; GPSA; GSA; GSP; NESP; PITA3; POH; SCG6; SgVI
Summary This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq, Aug 2012]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Calcium signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Long-term depression, Melanogenesis, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection
Write Your Own Review
You're reviewing:G protein alpha S (GNAS) (NM_001077489) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314197 GNAS MS Standard C13 and N15-labeled recombinant protein (NP_000507) 10 ug
$3,255.00
PH314318 GNAS MS Standard C13 and N15-labeled recombinant protein (NP_536351) 10 ug
$3,255.00
PH316883 GNAS MS Standard C13 and N15-labeled recombinant protein (NP_001070957) 10 ug
$3,255.00
LC402577 GNAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409171 GNAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421439 GNAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421440 GNAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424674 GNAS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402577 Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 4 100 ug
$436.00
LY409171 Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 3 100 ug
$436.00
LY421439 Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 6 100 ug
$436.00
LY421440 Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 7 100 ug
$436.00
LY424674 Transient overexpression lysate of GNAS complex locus (GNAS), transcript variant 1 100 ug
$436.00
TP314197 Recombinant protein of human GNAS complex locus (GNAS), transcript variant 1, 20 µg 20 ug
$737.00
TP314318 Recombinant protein of human GNAS complex locus (GNAS), transcript variant 3, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.