CD200 (NM_005944) Human Recombinant Protein

SKU
TP306356
Recombinant protein of human CD200 molecule (CD200), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206356 protein sequence
Red=Cloning site Green=Tags(s)

MERLVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV
SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY
VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK
EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005935
Locus ID 4345
UniProt ID P41217
Cytogenetics 3q13.2
RefSeq Size 2226
RefSeq ORF 807
Synonyms MOX1; MOX2; MRC; OX-2
Summary This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CD200 (NM_005944) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306356 CD200 MS Standard C13 and N15-labeled recombinant protein (NP_005935) 10 ug
$3,255.00
PH317941 CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196) 10 ug
$3,255.00
LC401799 CD200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424074 CD200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401799 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 100 ug
$436.00
LY424074 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2 100 ug
$436.00
TP317941 Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP724003 Human CD200 Protein, His Tag 100 ug
$565.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.