CD200 (NM_005944) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC206356] |
Predicted MW | 30.3 kDa |
Protein Sequence |
Protein Sequence
>RC206356 protein sequence
Red=Cloning site Green=Tags(s) MERLVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005935 |
RefSeq Size | 2226 |
RefSeq ORF | 807 |
Synonyms | MOX1; MOX2; MRC; OX-2 |
Locus ID | 4345 |
UniProt ID | P41217 |
Cytogenetics | 3q13.2 |
Summary | This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317941 | CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196) | 10 ug |
$3,255.00
|
|
LC401799 | CD200 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC424074 | CD200 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401799 | Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 | 100 ug |
$436.00
|
|
LY424074 | Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2 | 100 ug |
$436.00
|
|
TP306356 | Recombinant protein of human CD200 molecule (CD200), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP317941 | Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP724003 | Human CD200 Protein, His Tag | 100 ug |
$565.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.