OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD200 (NM_005944) Human Mass Spec Standard

Be the first to review this product
SKU
PH306356
CD200 MS Standard C13 and N15-labeled recombinant protein (NP_005935)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA343315 Rabbit Polyclonal Anti-CD200 Antibody
100 ul
$585.00
LY401799 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD200 or NM_005944"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC206356
Predicted MW 30.3 kDa
Protein Sequence
Protein Sequence
>RC206356 protein sequence
Red=Cloning site Green=Tags(s)

MERLVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV
SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY
VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK
EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005935
RefSeq Size 2226
RefSeq ORF 807
Synonyms MOX1; MOX2; MRC; OX-2
Locus ID 4345
UniProt ID P41217
Cytogenetics 3q13.2
Summary This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jan 2016
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD200" proteins (8)
SKU Description Size Price
PH317941 CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196) 10 ug
$3,360.00
LC401799 Lyophilized CD200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424074 Lyophilized CD200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401799 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY424074 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP306356 Recombinant protein of human CD200 molecule (CD200), transcript variant 1, 20 µg 20 ug
$867.00
TP317941 Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg 20 ug
$867.00
TP724003 Recombinant human CD200 protein with C-terminal 6×His tag 100 ug
$695.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products