CD200 (NM_001004196) Human Mass Spec Standard

SKU
PH317941
CD200 MS Standard C13 and N15-labeled recombinant protein (NP_001004196)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC217941]
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC217941 representing NM_001004196
Red=Cloning site Green=Tags(s)

MERLTLTRTIGGPLLTATLLGKTTINDYQVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYT
PASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLED
EGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVT
LSHPNGTTSVTSILHIKDPKNQVGKEVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISI
LLYWKRHRNQDREP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001004196
RefSeq Size 2247
RefSeq ORF 882
Synonyms MOX1; MOX2; MRC; OX-2
Locus ID 4345
UniProt ID P41217
Cytogenetics 3q13.2
Summary This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jan 2016]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CD200 (NM_001004196) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH306356 CD200 MS Standard C13 and N15-labeled recombinant protein (NP_005935) 10 ug
$3,255.00
LC401799 CD200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424074 CD200 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401799 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 1 100 ug
$436.00
LY424074 Transient overexpression lysate of CD200 molecule (CD200), transcript variant 2 100 ug
$436.00
TP306356 Recombinant protein of human CD200 molecule (CD200), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP317941 Purified recombinant protein of Homo sapiens CD200 molecule (CD200), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP724003 Human CD200 Protein, His Tag 100 ug
$565.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.