TXNL6 (NXNL1) (NM_138454) Human Recombinant Protein

  • Product Brand Image
SKU
TP304346
Recombinant protein of human nucleoredoxin-like 1 (NXNL1), 20 µg
In Control Promo
  $867.00
4 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204346 protein sequence
Red=Cloning site Green=Tags(s)

MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA
AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE
IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG
LF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_612463
Locus ID 115861
UniProt ID Q96CM4
Cytogenetics 19p13.11
RefSeq Size 948
RefSeq ORF 636
Synonyms RDCVF; TXNL6
Summary Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. provided by RefSeq, Dec 2015
Protein Categories Intracellular Proteins
Protein Families Druggable Genome
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "TXNL6" proteins (3)
SKU Description Size Price
PH304346 NXNL1 MS Standard C13 and N15-labeled recombinant protein (NP_612463) 10 ug
$3,360.00
LC408604 NXNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408604 Transient overexpression lysate of nucleoredoxin-like 1 (NXNL1) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.