TXNL6 (NXNL1) Rabbit Polyclonal Antibody

SKU TA337914

Rabbit Polyclonal Anti-NXNL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NXNL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NXNL1. Synthetic peptide located within the following region: LTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 24 kDa
• Gene Name: nucleoredoxin-like 1
• Database Link:
  NP_612463
  Q96CM4
• Background: NXNL1 may play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods.
• Synonyms: RDCVF; TXNL6
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%

Reference Data

• Protein Families: Druggable Genome