TXNL6 (NXNL1) (NM_138454) Human Mass Spec Standard

SKU
PH304346
NXNL1 MS Standard C13 and N15-labeled recombinant protein (NP_612463)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204346]
Predicted MW 23.9 kDa
Protein Sequence
Protein Sequence
>RC204346 protein sequence
Red=Cloning site Green=Tags(s)

MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA
AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE
IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG
LF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_612463
RefSeq Size 948
RefSeq ORF 636
Synonyms RDCVF; TXNL6
Locus ID 115861
UniProt ID Q96CM4
Cytogenetics 19p13.11
Summary Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. [provided by RefSeq, Dec 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:TXNL6 (NXNL1) (NM_138454) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408604 NXNL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408604 Transient overexpression lysate of nucleoredoxin-like 1 (NXNL1) 100 ug
$436.00
TP304346 Recombinant protein of human nucleoredoxin-like 1 (NXNL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.