TXNL6 (NXNL1) (NM_138454) Human Tagged ORF Clone

SKU
RC204346
NXNL1 (Myc-DDK-tagged)-Human nucleoredoxin-like 1 (NXNL1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TXNL6
Synonyms RDCVF; TXNL6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204346 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCCCTGTTCTCTGGCCGCATCCTGATCCGCAACAATAGCGACCAGGACGAGCTGGATACGGAGG
CTGAGGTCAGTCGCAGGCTGGAGAACCGGCTGGTGCTGCTGTTCTTTGGTGCTGGGGCTTGTCCACAGTG
CCAGGCCTTCGTGCCCATCCTCAAGGACTTCTTCGTGCGGCTCACAGATGAGTTCTATGTACTGCGGGCG
GCTCAGCTGGCCCTGGTGTACGTGTCCCAGGACTCCACGGAGGAGCAGCAGGACCTGTTCCTCAAGGACA
TGCCAAAGAAATGGCTTTTCCTGCCCTTTGAGGATGATCTGAGGAGGGACCTCGGGCGCCAGTTCTCAGT
GGAGCGCCTGCCGGCGGTCGTGGTGCTCAAGCCGGACGGGGACGTGCTCACTCGCGACGGCGCCGACGAG
ATCCAGCGCCTGGGCACCGCCTGCTTCGCCAACTGGCAGGAGGCGGCCGAGGTGCTGGACCGCAACTTCC
AGCTGCCAGAGGACCTGGAGGACCAGGAGCCACGGAGCCTCACCGAGTGCCTGCGCCGCCACAAGTACCG
CGTGGAAAAGGCGGCGCGAGGCGGGCGCGACCCCGGGGGAGGGGGTGGGGAGGAGGGCGGGGCCGGGGGG
CTGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC204346 protein sequence
Red=Cloning site Green=Tags(s)

MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRA
AQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADE
IQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGG
LF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_138454
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_138454.2
RefSeq Size 948 bp
RefSeq ORF 639 bp
Locus ID 115861
UniProt ID Q96CM4
Cytogenetics 19p13.11
Protein Families Druggable Genome
MW 23.9 kDa
Summary Retinitis pigmentosa (RP) is a disease that leads to blindness by degeneration of cone photoreceptors. Rods produce factors required for cone viability. The protein encoded by this gene is one of those factors and is similar to a truncated form of thioredoxin. This gene has been proposed to have therapeutic value against RP. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:TXNL6 (NXNL1) (NM_138454) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC204346L1 Lenti ORF clone of Human nucleoredoxin-like 1 (NXNL1), Myc-DDK-tagged 10 ug
$600.00
RC204346L2 Lenti ORF clone of Human nucleoredoxin-like 1 (NXNL1), mGFP tagged 10 ug
$600.00
RC204346L3 Lenti ORF clone of Human nucleoredoxin-like 1 (NXNL1), Myc-DDK-tagged 10 ug
$600.00
RC204346L4 Lenti ORF clone of Human nucleoredoxin-like 1 (NXNL1), mGFP tagged 10 ug
$600.00
RG204346 NXNL1 (tGFP-tagged) - Human nucleoredoxin-like 1 (NXNL1) 10 ug
$500.00
SC306027 NXNL1 (untagged)-Human nucleoredoxin-like 1 (NXNL1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.