EAF2 (NM_018456) Human Recombinant Protein

SKU
TP304314
Recombinant protein of human ELL associated factor 2 (EAF2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204314 protein sequence
Red=Cloning site Green=Tags(s)

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST
PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL
VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG
NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060926
Locus ID 55840
UniProt ID Q96CJ1
Cytogenetics 3q13.33
RefSeq Size 1024
RefSeq ORF 780
Synonyms BM040; TRAITS; U19
Summary Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EAF2 (NM_018456) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304314 EAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060926) 10 ug
$3,255.00
LC413036 EAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413036 Transient overexpression lysate of ELL associated factor 2 (EAF2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.