EAF2 Rabbit Polyclonal Antibody

SKU TA338035

Rabbit Polyclonal Anti-EAF2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EAF2 antibody is: synthetic peptide directed towards the C-terminal region of Human EAF2. Synthetic peptide located within the following region: SSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 29 kDa
• Gene Name: ELL associated factor 2
• Database Link:
  NP_060926
  Q96CJ1
• Background: EAF2 acts as a transcriptional transactivator of TCEA1 elongation activity and a transcriptional transactivator of ELL and ELL2 elongation activities. EAF2 is a potent inducer of apoptosis in prostatic and non-prostatic cell lines and inhibits prostate tumor growth in vivo.
• Synonyms: BM040; TRAITS; U19
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data