EAF2 (NM_018456) Human Mass Spec Standard

SKU
PH304314
EAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060926)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204314]
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC204314 protein sequence
Red=Cloning site Green=Tags(s)

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST
PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL
VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG
NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060926
RefSeq Size 1024
RefSeq ORF 780
Synonyms BM040; TRAITS; U19
Locus ID 55840
UniProt ID Q96CJ1
Cytogenetics 3q13.33
Summary Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EAF2 (NM_018456) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413036 EAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413036 Transient overexpression lysate of ELL associated factor 2 (EAF2) 100 ug
$436.00
TP304314 Recombinant protein of human ELL associated factor 2 (EAF2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.