OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EAF2 (NM_018456) Human Mass Spec Standard

Be the first to review this product
SKU
PH304314
EAF2 MS Standard C13 and N15-labeled recombinant protein (NP_060926)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA338035 Rabbit Polyclonal Anti-EAF2 Antibody
100 ul
$585.00
LY413036 Transient overexpression lysate of ELL associated factor 2 (EAF2) (as WB positive control) 100 ug
$436.00

Other products for "EAF2 or NM_018456"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204314
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC204314 protein sequence
Red=Cloning site Green=Tags(s)

MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGST
PPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNL
VKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTG
NCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060926
RefSeq Size 1024
RefSeq ORF 780
Synonyms BM040; TRAITS; U19
Locus ID 55840
UniProt ID Q96CJ1
Cytogenetics 3q13.33
Summary Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EAF2" proteins (3)
SKU Description Size Price
LC413036 Lyophilized EAF2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413036 Transient overexpression lysate of ELL associated factor 2 (EAF2) (as WB positive control) 100 ug
$436.00
TP304314 Recombinant protein of human ELL associated factor 2 (EAF2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products