TACD2 (TACSTD2) (NM_002353) Human Recombinant Protein

SKU
TP302519
Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202519 protein sequence
Red=Cloning site Green=Tags(s)

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT
SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD
LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS
QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV
IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002344
Locus ID 4070
UniProt ID P09758
Cytogenetics 1p32.1
RefSeq Size 2080
RefSeq ORF 969
Synonyms EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2
Summary This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TACD2 (TACSTD2) (NM_002353) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302519 TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344) 10 ug
$3,255.00
LC419381 TACSTD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419381 Transient overexpression lysate of tumor-associated calcium signal transducer 2 (TACSTD2) 100 ug
$436.00
TP721339 Human Trop2 Protein (C-His) 25 ug
$300.00
TP721340 Human Trop2 Protein (C-His-Avi) 25 ug
$300.00
TP721341 Biotinylated Human Trop2 Protein (C-His-Avi) 25 ug
$430.00
TP721342 PE Conjugated Human Trop2 Protein (C-His) 25 ug
$430.00
TP721343 APC Conjugated Human Trop2 Protein (C-His) 25 ug
$430.00
TP721344 Human Trop2 Protein (C-Fc) 25 ug
$300.00
TP721345 Human Trop2 Protein (C-Fc-Avi) 25 ug
$300.00
TP721346 Biotinylated Human Trop2 Protein (C-Fc-Avi) 25 ug
$430.00
TP721347 PE Conjugated Human Trop2 Protein (C-Fc) 25 ug
$430.00
TP721348 APC Conjugated Human Trop2 Protein (C-Fc) 25 ug
$430.00
TP724028 Human Trop2 Protein, mFc-His Tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.