OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TACD2 (TACSTD2) (NM_002353) Human Mass Spec Standard

Be the first to review this product
SKU
PH302519
TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA310025 Mouse anti-TACSTD2 (TROP-2) monoclonal antibody
100 ug
$520.00
LY419381 Transient overexpression lysate of tumor-associated calcium signal transducer 2 (TACSTD2) (as WB positive control) 100 ug
$436.00

Other products for "TACD2 or NM_002353"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202519
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC202519 protein sequence
Red=Cloning site Green=Tags(s)

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT
SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD
LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS
QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV
IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002344
RefSeq Size 2080
RefSeq ORF 969
Synonyms EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2
Locus ID 4070
UniProt ID P09758
Cytogenetics 1p32.1
Summary This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.provided by RefSeq, Dec 2009
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TACD2" proteins (14)
SKU Description Size Price
LC419381 Lyophilized TACSTD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419381 Transient overexpression lysate of tumor-associated calcium signal transducer 2 (TACSTD2) (as WB positive control) 100 ug
$436.00
TP302519 Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2), 20 µg 20 ug
$737.00
TP721339 Human Trop2 Protein (C-His) 25 ug
$300.00
TP721340 Human Trop2 Protein (C-His-Avi) 25 ug
$300.00
TP721341 Biotinylated Human Trop2 Protein (C-His-Avi) 25 ug
$430.00
TP721342 PE Conjugated Human Trop2 Protein (C-His) 25 ug
$430.00
TP721343 APC Conjugated Human Trop2 Protein (C-His) 25 ug
$430.00
TP721344 Human Trop2 Protein (C-Fc) 25 ug
$300.00
TP721345 Human Trop2 Protein (C-Fc-Avi) 25 ug
$300.00
TP721346 Biotinylated Human Trop2 Protein (C-Fc-Avi) 25 ug
$430.00
TP721347 PE Conjugated Human Trop2 Protein (C-Fc) 25 ug
$430.00
TP721348 APC Conjugated Human Trop2 Protein (C-Fc) 25 ug
$430.00
TP724028 Recombinant human Trop2 protein with C-terminal mouse Fc and 6×His tag 100 ug
$770.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products