TACD2 (TACSTD2) (NM_002353) Human Mass Spec Standard

SKU
PH302519
TACSTD2 MS Standard C13 and N15-labeled recombinant protein (NP_002344)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202519]
Predicted MW 35.7 kDa
Protein Sequence
Protein Sequence
>RC202519 protein sequence
Red=Cloning site Green=Tags(s)

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLT
SKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD
LSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTS
QKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAV
IVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002344
RefSeq Size 2080
RefSeq ORF 969
Synonyms EGP-1; EGP1; GA733-1; GA7331; GP50; M1S1; TROP2
Locus ID 4070
UniProt ID P09758
Cytogenetics 1p32.1
Summary This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy.[provided by RefSeq, Dec 2009]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TACD2 (TACSTD2) (NM_002353) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419381 TACSTD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419381 Transient overexpression lysate of tumor-associated calcium signal transducer 2 (TACSTD2) 100 ug
$436.00
TP302519 Recombinant protein of human tumor-associated calcium signal transducer 2 (TACSTD2), 20 µg 20 ug
$737.00
TP721339 Human Trop2 Protein (C-His) 25 ug
$300.00
TP721340 Human Trop2 Protein (C-His-Avi) 25 ug
$300.00
TP721341 Biotinylated Human Trop2 Protein (C-His-Avi) 25 ug
$430.00
TP721342 PE Conjugated Human Trop2 Protein (C-His) 25 ug
$430.00
TP721343 APC Conjugated Human Trop2 Protein (C-His) 25 ug
$430.00
TP721344 Human Trop2 Protein (C-Fc) 25 ug
$300.00
TP721345 Human Trop2 Protein (C-Fc-Avi) 25 ug
$300.00
TP721346 Biotinylated Human Trop2 Protein (C-Fc-Avi) 25 ug
$430.00
TP721347 PE Conjugated Human Trop2 Protein (C-Fc) 25 ug
$430.00
TP721348 APC Conjugated Human Trop2 Protein (C-Fc) 25 ug
$430.00
TP724028 Human Trop2 Protein, mFc-His Tag 100 ug
$595.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.