NEIL1 (NM_024608) Human Recombinant Protein
SKU
TP302329
Purified recombinant protein of Homo sapiens nei endonuclease VIII-like 1 (E. coli) (NEIL1), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC202329 representing NM_024608
Red=Cloning site Green=Tags(s) MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_078884 |
Locus ID | 79661 |
UniProt ID | Q96FI4 |
Cytogenetics | 15q24.2 |
RefSeq Size | 1896 |
RefSeq ORF | 1170 |
Synonyms | FPG1; hFPG1; NEI1 |
Summary | This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012] |
Protein Families | Druggable Genome |
Protein Pathways | Base excision repair |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302329 | NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884) | 10 ug |
$3,255.00
|
|
LC411199 | NEIL1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY411199 | Transient overexpression lysate of nei endonuclease VIII-like 1 (E. coli) (NEIL1) | 100 ug |
$436.00
|
|
TP762007 | Purified recombinant protein of Human nei endonuclease VIII-like 1 (E. coli) (NEIL1),Leu186-Ser390, with N-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.