NEIL1 (NM_024608) Human Recombinant Protein

SKU
TP302329
Purified recombinant protein of Homo sapiens nei endonuclease VIII-like 1 (E. coli) (NEIL1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202329 representing NM_024608
Red=Cloning site Green=Tags(s)

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ
EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE
YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL
TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW
FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE
APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 43.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_078884
Locus ID 79661
UniProt ID Q96FI4
Cytogenetics 15q24.2
RefSeq Size 1896
RefSeq ORF 1170
Synonyms FPG1; hFPG1; NEI1
Summary This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome
Protein Pathways Base excision repair
Write Your Own Review
You're reviewing:NEIL1 (NM_024608) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302329 NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884) 10 ug
$3,255.00
LC411199 NEIL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411199 Transient overexpression lysate of nei endonuclease VIII-like 1 (E. coli) (NEIL1) 100 ug
$436.00
TP762007 Purified recombinant protein of Human nei endonuclease VIII-like 1 (E. coli) (NEIL1),Leu186-Ser390, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.