NEIL1 (NM_024608) Human Mass Spec Standard

SKU
PH302329
NEIL1 MS Standard C13 and N15-labeled recombinant protein (NP_078884)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202329]
Predicted MW 43.7 kDa
Protein Sequence
Protein Sequence
>RC202329 representing NM_024608
Red=Cloning site Green=Tags(s)

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ
EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE
YQQFRESVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL
TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGRGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW
FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE
APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078884
RefSeq Size 1896
RefSeq ORF 1170
Synonyms FPG1; hFPG1; NEI1
Locus ID 79661
UniProt ID Q96FI4
Cytogenetics 15q24.2
Summary This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
Protein Families Druggable Genome
Protein Pathways Base excision repair
Write Your Own Review
You're reviewing:NEIL1 (NM_024608) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411199 NEIL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411199 Transient overexpression lysate of nei endonuclease VIII-like 1 (E. coli) (NEIL1) 100 ug
$436.00
TP302329 Purified recombinant protein of Homo sapiens nei endonuclease VIII-like 1 (E. coli) (NEIL1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP762007 Purified recombinant protein of Human nei endonuclease VIII-like 1 (E. coli) (NEIL1),Leu186-Ser390, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.