OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EPCAM (NM_002354) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301989
Recombinant protein of human epithelial cell adhesion molecule (EPCAM), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA506627 EPCAM mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)
100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EPCAM or NM_002354"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201989 representing NM_002354
Red=Cloning site Green=Tags(s)

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

TRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002345
Locus ID 4072
UniProt ID P16422
Cytogenetics 2p21
RefSeq Size 1528
RefSeq ORF 942
Synonyms DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1
Summary This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. provided by RefSeq, Dec 2008
Protein Categories ADC Targets, Cancer: Gastrointestinal, CAR-T Targets, CD Markers, Intracellular Proteins, Membrane Proteins
Protein Families ES Cell Differentiation/IPS, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EPCAM" proteins (16)
SKU Description Size Price
PH301989 EPCAM MS Standard C13 and N15-labeled recombinant protein (NP_002345) 10 ug
$3,360.00
LC400847 Lyophilized EPCAM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400847 Transient overexpression lysate of epithelial cell adhesion molecule (EPCAM) (as WB positive control) 100 ug
$436.00
TP710374 Purified recombinant protein of Human epithelial cell adhesion molecule (EPCAM), esidues 24-265aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00
TP720296 Recombinant protein of human epithelial cell adhesion molecule (EPCAM) 10 ug
$220.00
TP721349 Human Trop1/EpCAM Protein (C-His) 25 ug
$300.00
TP721350 Human Trop1/EpCAM Protein (C-His-Avi) 25 ug
$300.00
TP721351 Biotinylated Human Trop1/EpCAM Protein (C-His-Avi) 25 ug
$430.00
TP721352 PE Conjugated Human Trop1/EpCAM Protein (C-His) 25 ug
$430.00
TP721353 APC Conjugated Human Trop1/EpCAM Protein (C-His) 25 ug
$430.00
TP721354 Human Trop1/EpCAM Protein (C-Fc) 25 ug
$300.00
TP721355 Human Trop1/EpCAM Protein (C-Fc-Avi) 25 ug
$300.00
TP721356 Biotinylated Human Trop1/EpCAM Protein (C-Fc-Avi) 25 ug
$430.00
TP721357 PE Conjugated Human Trop1/EpCAM Protein (C-Fc) 25 ug
$430.00
TP721358 APC Conjugated Human Trop1/EpCAM Protein (C-Fc) 25 ug
$430.00
TP723976 Recombinant human EPCAM protein with C-terminal 6×His tag 100 ug
$695.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products