EPCAM (NM_002354) Human Mass Spec Standard

SKU
PH301989
EPCAM MS Standard C13 and N15-labeled recombinant protein (NP_002345)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201989]
Predicted MW 34.9 kDa
Protein Sequence
Protein Sequence
>RC201989 representing NM_002354
Red=Cloning site Green=Tags(s)

MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA

TRRLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002345
RefSeq Size 1528
RefSeq ORF 942
Synonyms DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1
Locus ID 4072
UniProt ID P16422
Cytogenetics 2p21
Summary This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]
Protein Families ES Cell Differentiation/IPS, Transmembrane
Write Your Own Review
You're reviewing:EPCAM (NM_002354) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400847 EPCAM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400847 Transient overexpression lysate of epithelial cell adhesion molecule (EPCAM) 100 ug
$436.00
TP301989 Recombinant protein of human epithelial cell adhesion molecule (EPCAM), 20 µg 20 ug
$737.00
TP710374 Purified recombinant protein of Human epithelial cell adhesion molecule (EPCAM), esidues 24-265aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP720296 Recombinant protein of human epithelial cell adhesion molecule (EPCAM) 10 ug
$215.00
TP721349 Human Trop1/EpCAM Protein (C-His) 25 ug
$300.00
TP721350 Human Trop1/EpCAM Protein (C-His-Avi) 25 ug
$300.00
TP721351 Biotinylated Human Trop1/EpCAM Protein (C-His-Avi) 25 ug
$430.00
TP721352 PE Conjugated Human Trop1/EpCAM Protein (C-His) 25 ug
$430.00
TP721353 APC Conjugated Human Trop1/EpCAM Protein (C-His) 25 ug
$430.00
TP721354 Human Trop1/EpCAM Protein (C-Fc) 25 ug
$300.00
TP721355 Human Trop1/EpCAM Protein (C-Fc-Avi) 25 ug
$300.00
TP721356 Biotinylated Human Trop1/EpCAM Protein (C-Fc-Avi) 25 ug
$430.00
TP721357 PE Conjugated Human Trop1/EpCAM Protein (C-Fc) 25 ug
$430.00
TP721358 APC Conjugated Human Trop1/EpCAM Protein (C-Fc) 25 ug
$430.00
TP723976 Human EPCAM Protein, His Tag 100 ug
$565.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.