c-Myc (MYC) (NM_002467) Human Recombinant Protein

SKU
TP301611
Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201611 representing NM_002467
Red=Cloning site Green=Tags(s)

LDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFEL
LPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPDDETFI
KNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQDLSAAASECIDPSVVF
PYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVV
SVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQ
ISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity ELISA binding assay (PMID: 25875098)
EMSA assay (PMID: 25892221)
ELISA capture for autoantibodies (PMID: 28191285)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002458
Locus ID 4609
UniProt ID P01106
Cytogenetics 8q24.21
RefSeq Size 2379
RefSeq ORF 1362
Synonyms bHLHe39; c-Myc; MRTL; MYCC
Summary This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to the E box DNA consensus sequence and regulates the transcription of specific target genes. Amplification of this gene is frequently observed in numerous human cancers. Translocations involving this gene are associated with Burkitt lymphoma and multiple myeloma in human patients. There is evidence to show that translation initiates both from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site, resulting in the production of two isoforms with distinct N-termini. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Embryonic stem cells, Induced pluripotent stem cells, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Stem cell relevant signaling - TGFb/BMP signaling pathway, Stem cell relevant signaling - Wnt Signaling pathway, Transcription Factors
Protein Pathways Acute myeloid leukemia, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Pathways in cancer, Small cell lung cancer, TGF-beta signaling pathway, Thyroid cancer, Wnt signaling pathway
Write Your Own Review
You're reviewing:c-Myc (MYC) (NM_002467) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301611 MYC MS Standard C13 and N15-labeled recombinant protein (NP_002458) 10 ug
$3,255.00
LC400876 MYC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400876 Transient overexpression lysate of v-myc myelocytomatosis viral oncogene homolog (avian) (MYC) 100 ug
$436.00
TP760019 Recombinant protein of human v-myc myelocytomatosis viral oncogene homolog (avian) (MYC), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00
TP762403 Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), Leu1-Asp343, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00
TP762404 Purified recombinant protein of Human v-myc myelocytomatosis viral oncogene homolog (avian) (Myc), His316-END, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.