OriGene Logo

DHRS11 (NM_024308) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301307
Recombinant protein of human dehydrogenase/reductase (SDR family) member 11 (DHRS11), 20 µg
Size:
20 ug 1 mg 100 ug
In Control Promo
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DHRS11 or NM_024308"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201307 protein sequence
Red=Cloning site Green=Tags(s)

MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD
LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN
VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH
DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_077284
Locus ID 79154
UniProt ID Q6UWP2
Cytogenetics 17q12
RefSeq Size 1608
RefSeq ORF 780
Synonyms ARPG836; SDR24C1; spDHRS11
Summary Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta-hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "DHRS11" proteins (3)
SKU Description Size Price
PH301307 DHRS11 MS Standard C13 and N15-labeled recombinant protein (NP_077284) 10 ug
$3,360.00
LC411327 DHRS11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411327 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 11 (DHRS11) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.