DHRS11 Rabbit Polyclonal Antibody

SKU TA338654

Rabbit Polyclonal Anti-DHRS11 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGC4172 antibody: synthetic peptide directed towards the C terminal of human MGC4172. Synthetic peptide located within the following region: VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 19 kDa
• Gene Name: dehydrogenase/reductase 11
• Database Link:
  NP_077284
  Q6UWP2
• Background: The function of DHRS11 remains unknown.
• Synonyms: ARPG836; SDR24C1; spDHRS11
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane