DHRS11 (NM_024308) Human Mass Spec Standard

SKU
PH301307
DHRS11 MS Standard C13 and N15-labeled recombinant protein (NP_077284)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201307]
Predicted MW 28.3 kDa
Protein Sequence
Protein Sequence
>RC201307 protein sequence
Red=Cloning site Green=Tags(s)

MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD
LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN
VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH
DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077284
RefSeq Size 1608
RefSeq ORF 780
Synonyms ARPG836; SDR24C1; spDHRS11
Locus ID 79154
UniProt ID Q6UWP2
Cytogenetics 17q12
Summary Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta-hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:DHRS11 (NM_024308) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411327 DHRS11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411327 Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 11 (DHRS11) 100 ug
$436.00
TP301307 Recombinant protein of human dehydrogenase/reductase (SDR family) member 11 (DHRS11), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.