DHRS11 (NM_024308) Human Tagged ORF Clone

SKU
RC201307
DHRS11 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 11 (DHRS11)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DHRS11
Synonyms ARPG836; SDR24C1; spDHRS11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201307 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAGGCCCGGCATGGAGCGGTGGCGCGACCGGCTGGCGCTGGTGACGGGGGCCTCGGGGGGCATCG
GCGCGGCCGTGGCCCGGGCCCTGGTCCAGCAGGGACTGAAGGTGGTGGGCTGCGCCCGCACTGTGGGCAA
CATCGAGGAGCTGGCTGCTGAATGTAAGAGTGCAGGCTACCCCGGGACTTTGATCCCCTACAGATGTGAC
CTATCAAATGAAGAGGACATCCTCTCCATGTTCTCAGCTATCCGTTCTCAGCACAGCGGTGTAGACATCT
GCATCAACAATGCTGGCTTGGCCCGGCCTGACACCCTGCTCTCAGGCAGCACCAGTGGTTGGAAGGACAT
GTTCAATGTGAACGTGCTGGCCCTCAGCATCTGCACACGGGAAGCCTACCAGTCCATGAAGGAGCGGAAT
GTGGACGATGGGCACATCATTAACATCAATAGCATGTCTGGCCACCGAGTGTTACCCCTGTCTGTGACCC
ACTTCTATAGTGCCACCAAGTATGCCGTCACTGCGCTGACAGAGGGACTGAGGCAAGAGCTTCGGGAGGC
CCAGACCCACATCCGAGCCACGTGCATCTCTCCAGGTGTGGTGGAGACACAATTCGCCTTCAAACTCCAC
GACAAGGACCCTGAGAAGGCAGCTGCCACCTATGAGCAAATGAAGTGTCTCAAACCCGAGGATGTGGCCG
AGGCTGTTATCTACGTCCTCAGCACCCCCGCACACATCCAGATTGGAGACATCCAGATGAGGCCCACGGA
GCAGGTGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201307 protein sequence
Red=Cloning site Green=Tags(s)

MARPGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIPYRCD
LSNEEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERN
VDDGHIININSMSGHRVLPLSVTHFYSATKYAVTALTEGLRQELREAQTHIRATCISPGVVETQFAFKLH
DKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTEQVT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_024308
ORF Size 780 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024308.4
RefSeq Size 1608 bp
RefSeq ORF 783 bp
Locus ID 79154
UniProt ID Q6UWP2
Cytogenetics 17q12
Domains adh_short
Protein Families Druggable Genome, Transmembrane
MW 28.3 kDa
Summary Catalyzes the conversion of the 17-keto group of estrone, 4- and 5-androstenes and 5-alpha-androstanes into their 17-beta-hydroxyl metabolites and the conversion of the 3-keto group of 3-, 3,17- and 3,20- diketosteroids into their 3-hydroxyl metabolites. Exhibits reductive 3-beta-hydroxysteroid dehydrogenase activity toward 5-beta-androstanes, 5-beta-pregnanes, 4-pregnenes and bile acids. May also reduce endogenous and exogenous alpha-dicarbonyl compounds and xenobiotic alicyclic ketones.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DHRS11 (NM_024308) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201307L3 Lenti ORF clone of Human dehydrogenase/reductase (SDR family) member 11 (DHRS11), Myc-DDK-tagged 10 ug
$600.00
RC201307L4 Lenti ORF clone of Human dehydrogenase/reductase (SDR family) member 11 (DHRS11), mGFP tagged 10 ug
$600.00
RG201307 DHRS11 (tGFP-tagged) - Human dehydrogenase/reductase (SDR family) member 11 (DHRS11) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC317371 DHRS11 (untagged)-Human dehydrogenase/reductase (SDR family) member 11 (DHRS11) 10 ug
$330.00
SC319105 DHRS11 (untagged)-Human dehydrogenase/reductase (SDR family) member 11 (DHRS11) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.