CD10 (MME) (NM_007287) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC223061] |
Predicted MW | 85.5 kDa |
Protein Sequence |
Protein Sequence
>RC223061 protein sequence
Red=Cloning site Green=Tags(s) MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_009218 |
RefSeq Size | 5619 |
RefSeq ORF | 2250 |
Synonyms | CALLA; CD10; CMT2T; NEP; SCA43; SFE |
Locus ID | 4311 |
UniProt ID | P08473 |
Cytogenetics | 3q25.2 |
Summary | The protein encoded by this gene is a type II transmembrane glycoprotein and a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). The encoded protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protease, Transmembrane |
Protein Pathways | Alzheimer's disease, Hematopoietic cell lineage, Renin-angiotensin system |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310961 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009219) | 10 ug |
$3,255.00
|
|
PH323013 | MME MS Standard C13 and N15-labeled recombinant protein (NP_000893) | 10 ug |
$3,255.00
|
|
PH323116 | MME MS Standard C13 and N15-labeled recombinant protein (NP_009220) | 10 ug |
$3,255.00
|
|
LC400326 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC416064 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC416065 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416066 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC425018 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429337 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429338 | MME HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY400326 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 | 100 ug |
$665.00
|
|
LY416064 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1bis | 100 ug |
$665.00
|
|
LY416065 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a | 100 ug |
$436.00
|
|
LY416066 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b | 100 ug |
$665.00
|
|
LY425018 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 | 100 ug |
$665.00
|
|
LY429337 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a | 100 ug |
$665.00
|
|
LY429338 | Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b | 100 ug |
$665.00
|
|
TP310961 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2a, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323013 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323061 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1bis, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP323116 | Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2b, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.