CD10 (MME) (NM_000902) Human Mass Spec Standard

SKU
PH323013
MME MS Standard C13 and N15-labeled recombinant protein (NP_000893)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC223013]
Predicted MW 85.3 kDa
Protein Sequence
Protein Sequence
>RC223013 representing NM_000902
Red=Cloning site Green=Tags(s)

MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI
QNMDATTEPCTDFFKYACGGWLKRNVIPETSSRYGNFDILRDELEVVLKDVLQEPKTEDIVAVQKAKALY
RSCINESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTAEKAIAQLNSKYGKKVLINLFVGTDDK
NSVNHVIHIDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEERLPIDENQLALEMNKVMELE
KEIANATAKPEDRNDPMLLYNKMTLAQIQNNFSLEINGKPFSWLNFTNEIMSTVNISITNEEDVVVYAPE
YLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRNAFRKALYGTTSETATWRRCANYVNGNME
NAVGRLYVEAAFAGESKHVVEDLIAQIREVFIQTLDDLTWMDAETKKRAEEKALAIKERIGYPDDIVSND
NKLNNEYLELNYKEDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL
QPPFFSAQQSNSLNYGGIGMVIGHEITHGFDDNGRNFNKDGDLVDWWTQQSASNFKEQSQCMVYQYGNFS
WDLAGGQHLNGINTLGENIADNGGLGQAYRAYQNYIKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP
EYAVNSIKTDVHSPGNFRIIGTLQNSAEFSEAFHCRKNSYMNPEKKCRVW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000893
RefSeq Size 5595
RefSeq ORF 2250
Synonyms CALLA; CD10; CMT2T; NEP; SCA43; SFE
Locus ID 4311
UniProt ID P08473
Cytogenetics 3q25.2
Summary The protein encoded by this gene is a type II transmembrane glycoprotein and a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). The encoded protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease, Hematopoietic cell lineage, Renin-angiotensin system
Write Your Own Review
You're reviewing:CD10 (MME) (NM_000902) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310961 MME MS Standard C13 and N15-labeled recombinant protein (NP_009219) 10 ug
$3,255.00
PH323061 MME MS Standard C13 and N15-labeled recombinant protein (NP_009218) 10 ug
$3,255.00
PH323116 MME MS Standard C13 and N15-labeled recombinant protein (NP_009220) 10 ug
$3,255.00
LC400326 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416064 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416065 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416066 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425018 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429337 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429338 MME HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400326 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 100 ug
$665.00
LY416064 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1bis 100 ug
$665.00
LY416065 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a 100 ug
$436.00
LY416066 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b 100 ug
$665.00
LY425018 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 1 100 ug
$665.00
LY429337 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2a 100 ug
$665.00
LY429338 Transient overexpression lysate of membrane metallo-endopeptidase (MME), transcript variant 2b 100 ug
$665.00
TP310961 Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2a, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323013 Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323061 Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 1bis, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP323116 Recombinant protein of human membrane metallo-endopeptidase (MME), transcript variant 2b, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.