SIRP alpha (SIRPA) (NM_001040023) Human Mass Spec Standard

SKU
PH316320
SIRPA MS Standard C13 and N15-labeled recombinant protein (NP_001035112)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC216320]
Predicted MW 55 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC216320
Blue=ORF Red=Cloning site Green=Tag(s)

MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWF
RGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGA
GTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSY
SIHSTAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVR
KFYPQRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSH
DLKVSAHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPE
KNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPK
QPAPKPEPSFSEYASVQVPRK

myc-FLAG tag

Recombinant protein using RC216320 also available, TP316320
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035112
RefSeq Size 4580
RefSeq ORF 1512
Synonyms BIT; CD172A; MFR; MYD-1; P84; PTPNS1; SHPS1; SIRP
Locus ID 140885
UniProt ID P78324
Cytogenetics 20p13
Summary The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kinase-coupled signaling processes. This protein can be phosphorylated by tyrosine kinases. The phospho-tyrosine residues of this PTP have been shown to recruit SH2 domain containing tyrosine phosphatases (PTP), and serve as substrates of PTPs. This protein was found to participate in signal transduction mediated by various growth factor receptors. CD47 has been demonstrated to be a ligand for this receptor protein. This gene and its product share very high similarity with several other members of the SIRP family. These related genes are located in close proximity to each other on chromosome 20p13. Multiple alternatively spliced transcript variants have been determined for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Phosphatase, Transmembrane
Write Your Own Review
You're reviewing:SIRP alpha (SIRPA) (NM_001040023) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH307315 SIRPA MS Standard C13 and N15-labeled recombinant protein (NP_542970) 10 ug
$3,255.00
PH322380 SIRPA MS Standard C13 and N15-labeled recombinant protein (NP_001035111) 10 ug
$3,255.00
LC409074 SIRPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421878 SIRPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421879 SIRPA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409074 Transient overexpression lysate of signal-regulatory protein alpha (SIRPA), transcript variant 3 100 ug
$436.00
LY421878 Transient overexpression lysate of signal-regulatory protein alpha (SIRPA), transcript variant 1 100 ug
$665.00
LY421879 Transient overexpression lysate of signal-regulatory protein alpha (SIRPA), transcript variant 2 100 ug
$665.00
TP307315 Recombinant protein of human signal-regulatory protein alpha (SIRPA), transcript variant 3, 20 µg 20 ug
$737.00
TP316320 Recombinant protein of human signal-regulatory protein alpha (SIRPA), transcript variant 2, 20 µg 20 ug
$737.00
TP322380 Recombinant protein of human signal-regulatory protein alpha (SIRPA), transcript variant 1, 20 µg 20 ug
$737.00
TP723932 Human SIRP alpha Protein, hFc-His Tag 100 ug
$650.00
TP762372 Purified recombinant protein of Human signal-regulatory protein alpha (SIRPA), transcript variant 1, Glu31-Ile373, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.