OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B7H3 (CD276) (NM_025240) Human Mass Spec Standard

Be the first to review this product
SKU
PH315291
CD276 MS Standard C13 and N15-labeled recombinant protein (NP_079516)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA813302 CD276 mouse monoclonal antibody, clone OTI1A10 100 ul
$447.00
LY410803 Transient overexpression lysate of CD276 molecule (CD276), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "B7H3 or NM_025240"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215291
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC215291 representing NM_025240
Red=Cloning site Green=Tags(s)

MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLT
DTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAA
PYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRV
VLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEE
ENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079516
RefSeq Size 2765
RefSeq ORF 948
Synonyms 4Ig-B7-H3; B7-H3; B7H3; B7RP-2
Locus ID 80381
UniProt ID Q5ZPR3
Cytogenetics 15q24.1
Summary The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "B7H3" proteins (9)
SKU Description Size Price
LC410803 Lyophilized CD276 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422539 Lyophilized CD276 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425464 Lyophilized CD276 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410803 Transient overexpression lysate of CD276 molecule (CD276), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422539 Transient overexpression lysate of CD276 molecule (CD276), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY425464 Transient overexpression lysate of CD276 molecule (CD276), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP315291 Recombinant protein of human CD276 molecule (CD276), transcript variant 2, 20 µg 20 ug
$737.00
TP700270 Purified recombinant protein of human CD276 molecule (CD276), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg 20 ug
$900.00
TP723935 Recombinant human B7-H3 protein with C-terminal mouse Fc and 6×His tag 100 ug
$795.00

file-alt Citations

B7-H3 Induces Ovarian Cancer Drugs Resistance Through An PI3K/AKT/BCL-2 Signaling Pathway
Zhou, Zhao
Cancer Manag Res (2019) 11, 10205-10214 DOI: 10.2147/CMAR.S222224
AI Summary: OriGene’s human B7-H3 (NM_025240) tagged ORF clone lentiviral particle was used to generate ovarian cancer cells with stable B7-H3 overexpression, enabling the study of B7-H3’s role in drug resistance and signaling pathways in this research.
Snippet: For stable overexpression of B7-H3, B7-H3 ({"type":"entrez-nucleotide","attrs":{" text":"NM_025240","term_id":"67188430","term_text":"NM_025240"}}NM_025240) human tagged ORF clone lentiviral particle was purchased from OriGene (MD, USA)
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products