BDH2 (NM_020139) Human Mass Spec Standard

SKU PH310586

BDH2 MS Standard C13 and N15-labeled recombinant protein (NP_064524)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC210586]
• Predicted MW: 26.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC210586 protein sequence; Red=Cloning site Green=Tags(s); ; MGRLDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFAN; EVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSVASSVKG; VVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGR; FATAEEIAMLCVYLASDESTYVTGNPVIIDGGWSL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_064524
• RefSeq Size: 2936
• RefSeq ORF: 735
• Synonyms: DHRS6; EFA6R; PRO20933; SDR15C1; UCPA-OR; UNQ6308
• Locus ID: 56898
• UniProt ID: Q9BUT1
• Cytogenetics: 4q24
• Summary: Dehydrogenase that mediates the formation of 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin and associates with LCN2, thereby playing a key role in iron assimilation and homeostasis. Plays a role in susceptibility to bacterial infection by providing an assimilable source of iron that is exploited by pathogenic bacteria (By similarity). Also acts as a 3-hydroxybutyrate dehydrogenase (PubMed:16380372).[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Metabolic pathways, Synthesis and degradation of ketone bodies