OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD3E (NM_000733) Human Mass Spec Standard

Be the first to review this product
SKU
PH308276
CD3E MS Standard C13 and N15-labeled recombinant protein (NP_000724)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506064 CD3E mouse monoclonal antibody,clone OTI3E10 100 ul
$447.00
LY400242 Transient overexpression lysate of CD3e molecule, epsilon (CD3-TCR complex) (CD3E) (as WB positive control) 100 ug
$436.00

Other products for "CD3E or NM_000733"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208276
Predicted MW 23.1 kDa
Protein Sequence
Protein Sequence
>RC208276 protein sequence
Red=Cloning site Green=Tags(s)

MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDE
DDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICI
TGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000724
RefSeq Size 1534
RefSeq ORF 621
Synonyms IMD18; T3E; TCRE
Locus ID 916
UniProt ID P07766
Cytogenetics 11q23.3
Summary The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage, Primary immunodeficiency, T cell receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD3E" proteins (6)
SKU Description Size Price
LC400242 Lyophilized CD3E HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400242 Transient overexpression lysate of CD3e molecule, epsilon (CD3-TCR complex) (CD3E) (as WB positive control) 100 ug
$436.00
TP308276 Recombinant protein of human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), 20 µg 20 ug
$867.00
TP700034 Recombinant protein of human CD3e molecule, epsilon (CD3-TCR complex) (CD3E), expressed in human cells 20 ug
$900.00
TP720690 Purified recombinant protein of Human CD3e molecule, epsilon (CD3-TCR complex) (CD3E) 10 ug
$275.00
TP790061 Purified recombinant protein of CD3-epsilon/delta heterodimers, with C-terminal His tag, secretory expressed in 293E cells, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products