HMGCS2 (NM_005518) Human Mass Spec Standard

SKU
PH308128
HMGCS2 MS Standard C13 and N15-labeled recombinant protein (NP_005509)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC208128]
Predicted MW 56.6 kDa
Protein Sequence
Protein Sequence
>RC208128 protein sequence
Red=Cloning site Green=Tags(s)

MQRLLTPVKRILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQ
TDLEKYNNVEAGKYTVGLGQTRMGFCSVQEDINSLCLTVVQRLMERIQLPWDSVGRLEVGTETIIDKSKA
VKTVLMELFQDSGNTDIEGIDTTNACYGGTASLFNAANWMESSSWDGRYAMVVCGDIAVYPSGNARPTGG
AGAVAMLIGPKAPLALERGLRGTHMENVYDFYKPNLASEYPIVDGKLSIQCYLRALDRCYTSYRKKIQNQ
WKQAGSDRPFTLDDLQYMIFHTPFCKMVQKSLARLMFNDFLSASSDTQTSLYKGLEAFGGLKLEDTYTNK
DLDKALLKASQDMFDKKTKASLYLSTHNGNMYTSSLYGCLASLLSHHSAQELAGSRIGAFSYGSGLAASF
FSFRVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTW
YLERVDEQHRRKYARRPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005509
RefSeq Size 2477
RefSeq ORF 1524
Locus ID 3158
UniProt ID P54868
Cytogenetics 1p12
Summary The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Protein Families Druggable Genome
Protein Pathways Butanoate metabolism, leucine and isoleucine degradation, Metabolic pathways, PPAR signaling pathway, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Valine
Write Your Own Review
You're reviewing:HMGCS2 (NM_005518) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417253 HMGCS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431416 HMGCS2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417253 Transient overexpression lysate of 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY431416 Transient overexpression lysate of 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$436.00
TP308128 Recombinant protein of human 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761046 Purified recombinant protein of Human 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial) (HMGCS2), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.